PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15580A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 408aa    MW: 44360.4 Da    PI: 7.4532
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15580AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding544e-171764148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+ Ed+llvd v+++G g+W+++ r+ g+ R++k+c++rw ++l
  Oropetium_20150105_15580A 17 KGPWTQAEDKLLVDHVQRHGEGNWNAVRRETGLQRCGKSCRLRWANHL 64
                               79******************************************9986 PP

2Myb_DNA-binding46.58.5e-1570113146
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                                +g++++eE+  +++++ + G++ W++I+++++ gRt++++k++w++
  Oropetium_20150105_15580A  70 KGPFSPEEERNILRLHGLIGNK-WARISSHLP-GRTDNEIKNYWNT 113
                                79********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.1761264IPR017930Myb domain
SuperFamilySSF466893.15E-3016111IPR009057Homeodomain-like
SMARTSM007171.6E-131666IPR001005SANT/Myb domain
PfamPF002494.3E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.8E-221871IPR009057Homeodomain-like
CDDcd001671.04E-111964No hitNo description
PROSITE patternPS0017503241IPR001345Phosphoglycerate/bisphosphoglycerate mutase, active site
PROSITE profilePS5129425.69865119IPR017930Myb domain
SMARTSM007172.7E-1569117IPR001005SANT/Myb domain
PfamPF002493.7E-1470113IPR001005SANT/Myb domain
CDDcd001674.64E-1172115No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2472118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008152Biological Processmetabolic process
GO:0003677Molecular FunctionDNA binding
GO:0003824Molecular Functioncatalytic activity
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MARTGSSGGE GGGASKKGPW TQAEDKLLVD HVQRHGEGNW NAVRRETGLQ RCGKSCRLRW  60
ANHLRPNLRK GPFSPEEERN ILRLHGLIGN KWARISSHLP GRTDNEIKNY WNTRLKRRQR  120
SGLPLYPPDI EREIATLRAQ NLNPFAADND GGNAASASNS FPPPLLFDAS NPFALPPTSG  180
PAAAHSPLIN QNYPLLNQMQ GMQQQQLYFA SQQVNPAFQQ DNHATGLILH HGDFSAALPP  240
LPNRVHELPS NQYDTASGSG LLGSLLLGDD YLPRPPNPSS MFRVGSMPEL MNRDTTISRM  300
LVHGGGASDS CDATSRCPPG ENHLHGGKWD FVMEGVKPAK RRAASEVELD VSGMSGTNNG  360
WFGGSSTAPS PGSASAVTDD EFNLEMQQYM TLSPLSLADE HNWNAQI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28171187107B-MYB
1h8a_C4e-281711827127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0387231e-129BT038723.1 Zea mays full-length cDNA clone ZM_BFb0313M23 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966213.11e-179PREDICTED: uncharacterized protein LOC101767992 isoform X1
TrEMBLK3XX971e-179K3XX97_SETIT; Uncharacterized protein
STRINGSi006555m1e-179(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123972632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.13e-58myb domain protein 33